PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G2331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 599aa    MW: 67160.1 Da    PI: 10.0707
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G2331genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-11281328552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  +r+rr++kNRe+A rsR+R++a++ eLe +  +L+ eN +Lk+ +ee 
  Gh_D13G2331 281 RRQRRMIKNRESAARSRARRQAYTVELELELNQLKRENAKLKQLVEEN 328
                  69************************************9888555443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-9277345IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.841279327IPR004827Basic-leucine zipper domain
PfamPF001702.5E-9281332IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.8E-11281330No hitNo description
SuperFamilySSF579596.06E-9281327No hitNo description
PROSITE patternPS000360284299IPR004827Basic-leucine zipper domain
SuperFamilySSF568087.59E-59367599IPR023674Ribosomal protein L1-like
Gene3DG3DSA:3.30.190.205.4E-48370424IPR016094Ribosomal protein L1, 2-layer alpha/beta-sandwich
CDDcd004032.37E-58373598IPR028364Ribosomal protein L1/ribosomal biogenesis protein
PfamPF006871.6E-36385594IPR028364Ribosomal protein L1/ribosomal biogenesis protein
Gene3DG3DSA:3.40.50.7904.0E-38426534IPR016095Ribosomal protein L1, 3-layer alpha/beta-sandwich
Gene3DG3DSA:3.30.190.205.4E-48535598IPR016094Ribosomal protein L1, 2-layer alpha/beta-sandwich
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MALSESESVA YGGIKKTGSP TQAPESPHEE STPDRSNSSP NKQNSIFSLT LDEIQLKSGK  60
TFGSMNMDEF LANLWNVEEN QQVMSQPEPI DGDRGIGCQP SLARQGSFSV PTPLCKKTVD  120
EVWFEIQKEL PQPREANDVA DHEPPQRQQT LGEITLEDFL IKAGVVQEPS GSSQQNKASP  180
LRINGASLDA NYIMDAPIRN NNASMDANFG MGHMIGLGFP GHQIVSNGYA AGYSIFAQTV  240
MGESSNGTEN GNRTNSLLQP AVAPQNKKRI VDGPPEVVVE RRQRRMIKNR ESAARSRARR  300
QAYTVELELE LNQLKRENAK LKQLVEENDK RRKEEVLKRK KELTCAKKKV DKMMTLRRTN  360
RDSKMSKLQS DALREAISTI VANSKEKSRK FTETIELQIG LKNYDPQKDK RFSGSVKLPH  420
IPRPKMKICM LGDAQHVEEA EKIGLDYMDV EALKKLNKNK KLVKKLAKKY HAFLASESVI  480
KQIPRLLGPG LNKAGKHLQG YYLYIDLSVG MVLGKFPTLV THQESLESKV NETKAMVKFQ  540
LKKVLCMGVA VGNVAMEEKQ IFQNVQMSVN FLVSLLKKNW QNVRCLYLKS TMGPSNRIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v3p_LA1e-1163655991216Ribosomal protein
4v7e_Cz1e-116365599121660S ribosomal protein L1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1453464KKLNKNKKLVKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.48460.0boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464119.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A0D2U7840.0A0A0D2U784_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.11e-64bZIP family protein